![]() |
Fasta format
A sequence in FASTA format begins with a single-line description, followed by
lines of sequence data. The description line is distinguished from the sequence
data by a greater-than (">") symbol in the first column. It is recommended that
all lines of the text should be shorter than 80 characters in length. Sequences
are expected to be represented in the standard IUB/IUPAC amino acid codes.
>MYPAT This is the name of my pat protein. In one line!
TYPLKLPPASSCVFGHKLMNVVVVDEQVREWTYPLKLPPASSCVFGHKLMNVVVVDEQVREWT
YPL
>MYPATWO This is the name of my other pat protein. In one line!
ACFGHIKLMPQRTYVVFGHKLPPASSCVFGHKLMNVVVVDEQVREWTYPLLLASWERTYMCDK
TYPLKLPPAS
|
| back |